SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420197|ref|YP_147515.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420197|ref|YP_147515.1|
Domain Number 1 Region: 2-248
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.43e-66
Family ABC transporter ATPase domain-like 0.000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56420197|ref|YP_147515.1|
Sequence length 254
Comment branched-chain amino acid ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MLLHVERLTKRFGGLLAVNDVTFSVEQGKINAIIGPNGAGKSTFFNLISGLYRPTSGTIT
FKGRDITRLPANERAKLGIARTFQTTHLFEQATVIDNVIIGHRLRTSSNLFDAILRTKRH
RREEQACKEKAMEVLDFVGLTHVADRMVANLSQEQKKRAAFALALATDPELVLLDEPAAG
INPDETEGLEELIVKMIEGGLTVCLIEHKMSMIMKIADRIMVLNYGEKIAEGTPEEVRNN
EAVIQAYLGGSAIA
Download sequence
Identical sequences A0A098L2G3 A0A1D7NBC3 A0A1V9BY88 A0A2H5KE56 G8N5W9 Q5KZD9 T0QCF3 V6VBE9
235909.GK1662 gi|375008700|ref|YP_004982333.1| gi|56420197|ref|YP_147515.1| WP_011231157.1.100150 WP_011231157.1.2219 WP_011231157.1.25743 WP_011231157.1.38928 WP_011231157.1.60903 WP_011231157.1.6497 WP_011231157.1.70239 WP_011231157.1.78869 WP_011231157.1.8599 WP_011231157.1.90668 WP_011231157.1.91533 WP_011231157.1.93593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]