SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56420273|ref|YP_147591.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420273|ref|YP_147591.1|
Domain Number 1 Region: 2-135
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.46e-35
Family Z-DNA binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56420273|ref|YP_147591.1|
Sequence length 147
Comment hypothetical protein GK1738 [Geobacillus kaustophilus HTA426]
Sequence
MQLTNYTEYALRVLLFLGALDEEEKTNIKDIAAAFSISEHHLSKIVYELGKLGYIETIRG
RNGGIRLAKRPAEIVIGAVVRETEENLSLVECFAAHGNECVLTPVCRLRFALHEALEAFL
RVLDAYTLADLLEDRASLRSLLKERRG
Download sequence
Identical sequences A0A063YQ07 A0A098L538 A0A0E0TBQ0 A0A0K2HDL6 A0A142D0J5 A0A1C3D325 A0A1V9CI21 A0A2H5KE32 G8N6K7 L7ZZR2 Q5KZ63 S7U216 U2YCI0 V6V9G6
gi|297530100|ref|YP_003671375.1| gi|56420273|ref|YP_147591.1| 235909.GK1738 544556.GYMC61_2545 gi|375008792|ref|YP_004982425.1| gi|448237994|ref|YP_007402052.1| APC36170 WP_011231230.1.17728 WP_011231230.1.19233 WP_011231230.1.20723 WP_011231230.1.2219 WP_011231230.1.22479 WP_011231230.1.25743 WP_011231230.1.38928 WP_011231230.1.46340 WP_011231230.1.50933 WP_011231230.1.59104 WP_011231230.1.6497 WP_011231230.1.78869 WP_011231230.1.80994 WP_011231230.1.8599 WP_011231230.1.90668 WP_011231230.1.91533 WP_011231230.1.9165 WP_011231230.1.92435 WP_011231230.1.93593 gi|261419938|ref|YP_003253620.1| gi|319766752|ref|YP_004132253.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]