SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420326|ref|YP_147644.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420326|ref|YP_147644.1|
Domain Number 1 Region: 5-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.9e-57
Family RecA protein-like (ATPase-domain) 0.0000714
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56420326|ref|YP_147644.1|
Sequence length 181
Comment cobalamin adenosyltransferase [Geobacillus kaustophilus HTA426]
Sequence
MPTPRRSGRVIVYTGDGKGKTTAALGLALRAVGRGMNVAVLQFLKSPERTYGEQLALERL
GVDVRQLGAGFTWTKTPDIHREALKRAWAVAKEYVYSGRYDMIVLDELNNVLAIDRFPVE
DIVSVSEVLELIRTRPPSLHLVITGRAARPELMAAADIVTEMKLIKHDYEQGRTAMKGIE
F
Download sequence
Identical sequences A0A098L4X1 A0A1V9BX86 G8N788 Q5KZ10 T0Q3U4 U2X424 V6V8A5
gka001001791.1 235909.GK1791 gi|375008863|ref|YP_004982496.1| gi|56420326|ref|YP_147644.1| WP_011231283.1.100150 WP_011231283.1.2219 WP_011231283.1.25743 WP_011231283.1.45808 WP_011231283.1.60903 WP_011231283.1.70239 WP_011231283.1.78869 WP_011231283.1.8599 WP_011231283.1.91533 WP_011231283.1.93593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]