SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420403|ref|YP_147721.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420403|ref|YP_147721.1|
Domain Number 1 Region: 625-788
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.09e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0008
Further Details:      
 
Domain Number 2 Region: 2-192
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.89e-45
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0013
Further Details:      
 
Domain Number 3 Region: 142-305
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.89e-30
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0018
Further Details:      
 
Domain Number 4 Region: 492-615
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.89e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56420403|ref|YP_147721.1|
Sequence length 808
Comment assimilatory nitrite reductase subunit [Geobacillus kaustophilus HTA426]
Sequence
MKRKLVLIGNGMAGVRCIEEILKLDREAFEITIFGSEPHPNYNRILLSKVLQGDTRLDDI
TLNSWEWYERNGIRLFVGETVTEVDIKRRLVRTDRGRVVEYDELIFATGSNPFILPVPGA
DLPGVTAFRDIQDCERMIEYAKTYKKAAVIGGGLLGLEAARGLLHLGMDVDVIHIFDYLM
ERQLDPTASKLLQRELEKQGMNFLLRKETAELFGNGRVEGVRFKDGTSIAADLVVMAVGI
RPNVELARKSGIEVNRGIVVNDYLETSVPHIYAVGECAEHRGVVYGLVAPLYEQGKVLAQ
AICGRKGKPYEGSVVSTQLKVSGVDVFSAGEFMDVEGTESIKLYDEARSVYKKVVVREGK
IVGAVLFGDTSEGRKLFDMIQRGDSLEALSLSLLAPASSGGKGSLVAAMADTDVVCGCNG
VTKGAICQAIAEHGLKTVAEVRDYTNASRSCGGCKGLVAELLEHMLGEEANRYAVKETIC
GCTDLSREEVLEAIEQRRLMTVKEVMSVLGWKNEEGCSKCRPALNYYLGMLYPGEYDEEA
ESLFVNERLHANIQADGTYSVVPRIYGGVTTAEQLRNIADVAEKYNVPMIKITGGQRIDL
LGVKKEDLPRIWADLGMPSGYAYAKALRTVKTCVGKQFCRFGTQDSTGLGIRMEQTFERL
KTPHKVKMAVSACPRNCAESGIKDVGVVGVEGGWEIYVGGNGGTHLRAADLLCTVKTEDE
VIEMTGAFLQYYRESAHYLERTSKWVERVGLEHIREVLFDVETRRALLERLHKALSATKD
PWREIVENERLQQLLFRDIGDKEPVPVE
Download sequence
Identical sequences Q5KYT3
gi|56420403|ref|YP_147721.1| 235909.GK1868 WP_011231358.1.2219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]