SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420468|ref|YP_147786.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420468|ref|YP_147786.1|
Domain Number 1 Region: 3-220
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.48e-58
Family ABC transporter ATPase domain-like 0.0000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56420468|ref|YP_147786.1|
Sequence length 233
Comment ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MLCLRNVTAGYDESVVLDQVRMDIPLSRVTAVLGRNGVGKTTLMKTIIGLIRPMSGVIEW
EGEDITRWPPERRARAGIGYVPQGREIFSALTVEENILLGLEAQAENVRPQPILEEMYAL
FPVLKEMRQRKGGDLSGGQQQQLAIARALAGRPKLLLLDEPMEGIQPSIVELIHDVIMKI
AEEKQVGIVLVEHNVELAFSCADRFYILDRGTVVAKGDVDGADLTYIQSFLAV
Download sequence
Identical sequences A0A1D7NC19 A0A1V4PB57 A0A1V9BRB5 A0A2H5KDM2 Q5KYL8 T0QBB3 V6VK31
235909.GK1933 WP_011231419.1.100150 WP_011231419.1.2219 WP_011231419.1.25743 WP_011231419.1.3446 WP_011231419.1.6497 WP_011231419.1.70239 gi|56420468|ref|YP_147786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]