SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420511|ref|YP_147829.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420511|ref|YP_147829.1|
Domain Number 1 Region: 1-234
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.2e-84
Family ABC transporter ATPase domain-like 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56420511|ref|YP_147829.1|
Sequence length 242
Comment glutamine ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MIYFHQVNKYYGDFHVLKDINLTINQGEVVVIIGPSGSGKSTLVRCINRLETISSGELIV
DGVKVNDKHININELRRNIGMVFQHFNLYPHMTVLQNITLAPRKVLGMSEKEANEIAMYY
LEKVGIPDKANAYPSALSGGQQQRVAIARGLAMKPKIMLFDEPTSALDPETIGEVLDVMK
QLAKEGMTMVVVTHEMGFAREVADRIVFMDQGRILEEAPPEEFFAAPKEERARVFLSRIL
NH
Download sequence
Identical sequences A0A1Q5T1V6 A0A1V4PAT9 Q5KYH5
gi|56420511|ref|YP_147829.1| 235909.GK1976 WP_011231462.1.2219 WP_011231462.1.3446 WP_011231462.1.77642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]