SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420545|ref|YP_147863.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420545|ref|YP_147863.1|
Domain Number 1 Region: 7-244
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.68e-87
Family ABC transporter ATPase domain-like 0.000000395
Further Details:      
 
Domain Number 2 Region: 240-364
Classification Level Classification E-value
Superfamily MOP-like 0.00000000000113
Family ABC-transporter additional domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56420545|ref|YP_147863.1|
Sequence length 367
Comment ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MQVANDVELKGVYKQIGRNVILNGINLQVKQGELLTLLGPSGCGKTSTLNTIAGFLDIDK
GEVFIKGKNVTNIPPYKRGLGMVFQTYSLFPHMTVYENLDFGLSLRKVPKEERRKRIEQA
LELVKMSGLEKRYPRELSGGQRQRVAIARALVVQPMLLLLDEPLSNLDAKLRYELRAEIK
RLQKEVGVTTIFVTHDQEEALSLSDRIVVMNKGTIEQVGTPTEIYEHPCTEFVFQFIGKS
NQFEGKVKTIDSRMICVELEGNTQIFIESKNMMGSNRSYSIGDRVKLYIRPEKLTIQEQE
SEPEIFYYNKYNASIVQMNYLGSAWEIELLLFRKRVQVLQPFVKSDWKIGAEVTVGWNPS
DMMIVKK
Download sequence
Identical sequences Q5KYE1
235909.GK2010 WP_011231496.1.2219 gi|56420545|ref|YP_147863.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]