SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420563|ref|YP_147881.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420563|ref|YP_147881.1|
Domain Number 1 Region: 4-235
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.49e-55
Family ABC transporter ATPase domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56420563|ref|YP_147881.1|
Sequence length 267
Comment ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MRRMLQLKGIYKVFHEGTPDEKIALQNIHLTLRKGDFVTVIGSNGAGKSTLMNLISGVLF
PDEGTIWIDGQDVTMMPEYVRSRYIGRVFQDPMAGTAPNMTIEENLAMAYTRNQKRTLRR
GVTKKRRDDFRELLSTLHLGLENRLQAKVGLLSGGERQALSLLMATFTEPAILLLDEHTA
ALDPARAELITNLTKEIVERYRLTTLMVTHNMQQAIDLGNRLIMMDKGQIIFEVDENEKK
SLTVEKLLAEFQRIRGEQLASDRAVLS
Download sequence
Identical sequences Q5KYC3 V6VLC8
gi|56420563|ref|YP_147881.1| 235909.GK2028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]