SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420711|ref|YP_148029.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420711|ref|YP_148029.1|
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.73e-53
Family DnaQ-like 3'-5' exonuclease 0.002
Further Details:      
 
Domain Number 2 Region: 270-324,406-476,651-665,699-870
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.59e-25
Family Tandem AAA-ATPase domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56420711|ref|YP_148029.1|
Sequence length 909
Comment bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon [Geobacillus kaustophilus HTA426]
Sequence
MATRFVIIDLETTGNGPKKGDRIIQLGMAVVEDGLIVERFASFFNPEQPIPLFIQQLTNI
NEEMVEGAPLFADKAGEIAALMHGAYFVAHNVDFDLPFLQAELERAGWPPFSGPTIDTVE
LARIVLPTAESYKLGDLARQLGLHHNRPHQADSDAEVTAKLFIALLKRLSRLPLMTLEQL
RGLARHLKSDIYLLLDAVIAKKRNKAPADRAVAVYRGIALKQPAPEPDESDRRPALASFA
AFCEQEPPLPLPGYKRRAGQWEMMRLVYEALSTSQHALIEAGTGLGKSLAYLIPAAFFAC
EQQERVVISTHTLQLQEQLIRRDWPVLRQIAPFPLRVAVLKGKQNYLSLDKFASFLSEPS
DTYDAALLKCQVLVWLLETDSGDLDELNVSSGARLLLSALAIGEEEDGGRHHFFARAKER
SERADVVITNHALLLHDLTGPAPLLPPFRHLIIDEAHRLEDAAARCFGEQISYVSFRLLT
AKIAQTIAKWQEAEQDAPNGALVRCQQRLEELQFEGDELFRLLRRYALDKKPARAGRCRY
RFSPTDEQSRAWQAAVELCWRLRDLAAALSAEAKPLLSADTSGDFPPSALLSADLAALNR
QMAALVRLLTEKEPGVVRWIEADEKGAANAVRLYSQPVDLADFFADQLFMKKRSVVLTSA
TLTVRGRFTYMAARLGLEDFYPLCRSFPSPFRYEEQAALFVPADMPLVSAVPLEDYAEAV
AASVLAIARRLGRRVLVLFPSYELLKLTVDALKTEEEGEPFVLIAQGVQSGSPAKLLRTF
LQFEHAVLFGTSSFWEGVDLPGSALDVLVIARLPFAPPDDPVMEAKSERIRLEGGDPFSE
LALPEAVLRFKQGFGRLIRTEDDKGAVFVLDRRLLASPYGADFLASLPPLSVHEGALSEL
LDKAETWLS
Download sequence
Identical sequences Q5KXX5
235909.GK2176 WP_011231661.1.2219 gi|56420711|ref|YP_148029.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]