SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420756|ref|YP_148074.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420756|ref|YP_148074.1|
Domain Number 1 Region: 138-433
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.53e-72
Family G proteins 0.0000317
Further Details:      
 
Domain Number 2 Region: 4-170
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.11e-47
Family G proteins 0.0000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56420756|ref|YP_148074.1|
Sequence length 436
Comment GTP-binding protein EngA [Geobacillus kaustophilus HTA426]
Sequence
MANPVVAIVGRPNVGKSTIFNRIVGERISIVEDVPGVTRDRIYSRAEWLNHSFYLIDTGG
IDIGDEPLLVQIRQQAEIAIDEADVIIFMTNGRDGVTAADEEVAKLLRRSNKPVVLAVNK
IDNPEMRDLIYDFYALGFGEPYPISGAHGTGLGDLLDAVVRHFPKGGGQEYEEDVIKFCL
IGRPNVGKSSLVNAILGEERVIVSDIAGTTRDAVDTSFVREGQEYVIIDTAGMRKRGKIY
ESTEKYSVLRALRAIERSDVVLVVLNAEEGIIEQDKKIAGYAHEAGRGVILIVNKWDAIE
KDDKTMVEFERKIRDHFPFLDYAPILFVSAKTKQRLHKLLPLVRLVSDNHAMRVQTNVLN
EVIMDAVAMNPTPTHNGRRLKVYYMTQVAVKPPTFVAFVNDPELMHFSYERFLENRIRDA
FGFEGTPIKIIARPRK
Download sequence
Identical sequences A0A1V9BSC6 G8MZP0 Q5KXT0 V6VG94
gi|56420756|ref|YP_148074.1| WP_011231705.1.2219 WP_011231705.1.25743 WP_011231705.1.70239 WP_011231705.1.8599 WP_011231705.1.90668 WP_011231705.1.93593 235909.GK2221 gi|375009278|ref|YP_004982911.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]