SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420793|ref|YP_148111.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420793|ref|YP_148111.1|
Domain Number 1 Region: 65-138
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000127
Family RecA protein-like (ATPase-domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56420793|ref|YP_148111.1|
Sequence length 138
Comment hypothetical protein GK2258 [Geobacillus kaustophilus HTA426]
Sequence
MHFVIGGAFQGKRKWVRERYGINDGVHIVWHNGYVEPYRPPDGIETAKTVVFDGLEAAIR
PRPDPDEWESYFRAWQRWEAAAPNRTVVWIGTDVTQGVVPVDPQERRWRDAVGMCYQRLA
SLCCRVDRLWCGLAEQLK
Download sequence
Identical sequences A0A063YQD9 A0A1D7NCU9 A0A1V9BW31 A0A2H5KLM8 L8A0G1 Q5KXP3
235909.GK2258 WP_011231741.1.100150 WP_011231741.1.17728 WP_011231741.1.19233 WP_011231741.1.2219 WP_011231741.1.25743 WP_011231741.1.45808 WP_011231741.1.60903 WP_011231741.1.6497 WP_011231741.1.70239 WP_011231741.1.90668 WP_011231741.1.93593 gi|56420793|ref|YP_148111.1| gi|448238550|ref|YP_007402608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]