SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420796|ref|YP_148114.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420796|ref|YP_148114.1|
Domain Number 1 Region: 2-178
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.48e-35
Family RecA protein-like (ATPase-domain) 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56420796|ref|YP_148114.1|
Sequence length 185
Comment bifunctional cobalamin biosynthesis protein (cobinamide kinase; cobinamide phosphate guanylyltransferase) [Geobacillus kaustophilus HTA426]
Sequence
MMVFVSGAARSGKSEAAEICAIRLSRGGRLHYIATAQAMDEEMTERIRRHQERRAAQAAH
WTVWEAPFSSQEIAASLHPDDVVLLDCLTTWLAHELFFGENWKTDATAQAVACRMLDEVR
AWADACRAVVIVSNELFAGGVPDDPGTFRYMKTLGLLHQQLVAEAAAAAVVECGLLRVKK
GRWPG
Download sequence
Identical sequences A0A1D7NCZ5 A0A1V9BVU1 A0A2H5KLN3 G8N0G1 Q5KXP0 V6VDI1
WP_011231744.1.100150 WP_011231744.1.2219 WP_011231744.1.25743 WP_011231744.1.45808 WP_011231744.1.60903 WP_011231744.1.6497 WP_011231744.1.70239 WP_011231744.1.78869 WP_011231744.1.8599 WP_011231744.1.90668 WP_011231744.1.91533 WP_011231744.1.93593 gi|56420796|ref|YP_148114.1| 235909.GK2261 gi|375009318|ref|YP_004982951.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]