SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420799|ref|YP_148117.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420799|ref|YP_148117.1|
Domain Number 1 Region: 3-230
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.43e-65
Family ABC transporter ATPase domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56420799|ref|YP_148117.1|
Sequence length 490
Comment ferric ion ABC transporter permease [Geobacillus kaustophilus HTA426]
Sequence
MMMLEVRAVSHRYGPKQVLDRVTFSVEKGELFGIVGPNGSGKTTLLKLICKELPLASGEI
KIHGQPLLALSAKQWARFAAVLPQTAEAAPGYTVRETVALGRYAHQRGLFPTWTKEDEAA
VQEALRAVGLADKIDEPLERLSGGERQRAYLARALAQKPQLLLLDEPTNHMDVSGQVRLL
DRLAEAARSRDLTVVAVFHDMNVASLYCDRVLVLKEGKTAALGTPTDVMTPALLEEVFAA
PIVRLAHPAAAKPMFSFVPKGKQEESSAGGLRLSFLDDAAVLASCQPLRVLSSALIGAGF
QWATHFVNRQVGLDYDCGDAEGDMRRYLEQHGFSPERTIGMMTAVDVHDAVWLQKEGEAF
SVAIMTTAGVGNAVDAARAWQHKPLAARPGTINMVIVIDGVLTEAAFVQAMMTATEAKVK
ALADCSVCDLETGTLATGTSTDSLAVAATQTGRTFAYAGTATELGRAIGRLVYEATIEAL
DRYKRRRGRR
Download sequence
Identical sequences A0A098L276 A0A1D7ND07 A0A1V9BWB5 A0A2H5KLP0 G8N0G4 Q5KXN7 T0Q150 U2X1T6
WP_011231747.1.100150 WP_011231747.1.2219 WP_011231747.1.45808 WP_011231747.1.60903 WP_011231747.1.6497 WP_011231747.1.70239 WP_011231747.1.78869 WP_011231747.1.8599 WP_011231747.1.91533 WP_011231747.1.93593 235909.GK2264 gi|56420799|ref|YP_148117.1| gi|375009321|ref|YP_004982954.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]