SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420899|ref|YP_148217.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420899|ref|YP_148217.1|
Domain Number 1 Region: 3-224
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.89e-56
Family ABC transporter ATPase domain-like 0.0000743
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56420899|ref|YP_148217.1|
Sequence length 288
Comment ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MAVVIEGLTKIVKKKPILSDVSLTLSGVYGLLGPNGAGKTTLMRIVAGLLEFNAGRVSLG
DEPISTGARVKRVNEIGYLPQEFMMYPELTMYEVLEHLAVLQGEHPAACRSKIEKVIEQV
NLSSHLNKKMRELSGGMRRRVGIAMLLLREPSILLFDEPTAGLDIRERVRFRNLLKRLGH
DHTIVISSHLVEDIEFLCTKIGVLDRGVVLFEGSPDELKQKAAPYTYELDVPLEELDSVM
AANEVVQMSEEPSHVVVRVLSEQPIGRPVAPRLMDGYLALLKEAEAHG
Download sequence
Identical sequences A0A063YM00 A0A0K1K903 A0A0N0I3T7 A0A161V1X3 Q5KXD7
WP_011231846.1.19233 WP_011231846.1.2219 235909.GK2364 gi|56420899|ref|YP_148217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]