SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420919|ref|YP_148237.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|56420919|ref|YP_148237.1|
Domain Number - Region: 4-64
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0106
Family ABC transporter transmembrane region 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56420919|ref|YP_148237.1|
Sequence length 82
Comment hypothetical protein GK2384 [Geobacillus kaustophilus HTA426]
Sequence
MGRMIALLILVIPGLGAALGIKWMRDALFGINGPLFSALWLQFLAGLALFAAGLAFLGGF
LLHRDRKRNKVQARFQRKRKTP
Download sequence
Identical sequences A0A063YM17 A0A1D7ND90 A0A1Q5ST37 A0A1V4P5G2 A0A1V9CT60 A0A2H5KLC0 G5EBA8 G8N1H5 Q75TA9 S7SY48 T0NSL4 U2X388 V6VD41
gi|375009445|ref|YP_004983078.1| WP_011231866.1.100150 WP_011231866.1.13089 WP_011231866.1.19233 WP_011231866.1.2219 WP_011231866.1.25743 WP_011231866.1.3446 WP_011231866.1.38260 WP_011231866.1.45808 WP_011231866.1.60903 WP_011231866.1.6497 WP_011231866.1.70239 WP_011231866.1.77642 WP_011231866.1.78869 WP_011231866.1.8599 WP_011231866.1.90668 WP_011231866.1.91533 WP_011231866.1.92435 WP_011231866.1.93593 gi|56420919|ref|YP_148237.1| 235909.GK2384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]