SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420924|ref|YP_148242.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420924|ref|YP_148242.1|
Domain Number 1 Region: 1-218
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.65e-65
Family ABC transporter ATPase domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 4-50,357-520
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.84e-31
Family ABC transporter ATPase domain-like 0.031
Further Details:      
 
Weak hits

Sequence:  gi|56420924|ref|YP_148242.1|
Domain Number - Region: 180-370
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00175
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56420924|ref|YP_148242.1|
Sequence length 573
Comment DNA repair protein [Geobacillus kaustophilus HTA426]
Sequence
MLAELSIKNFAIIESLSLSFDKGLTVLTGETGAGKSIIIDAIHLLIGGRGSAEFVRFGAE
KAEIEGLFLLDDDRHPCWQKCADVGIDASDGMIVLRRDIFANGKSVCRINGKLVTTAVLR
DIGATLVDIHGQHEHQELMDPSRHLPLLDEFGGLEAAEALARYRAVYERYEELGNKLKKL
SENEQQMAHRLDLLTFQLREIEQAALEPGEDERLMEEKVRIVNFQKIYTALQKSYEALSG
EGRGLDSIGEAMRHLDDVAGMDAALKDAHETTANCYYLLEEVMYKLRDQIEEMEYDPERL
DAIESRLAEIGQLKRKYGATIADILHYAETIAEEIETIENRETHVHELKQQLALVTDELL
TEAKNVTAVRQTYARRLIERIHQELKDLYMDKTKFDIVFAKREGSLDAPLVDGVPVRFQE
DGIDVVEFYISTNVGEPLKPLVKVASGGELSRIMLALKTIFSKHQGVTSIVFDEVDTGVS
GRVAQAMAEKIYRIASQSQVLCISHLPQVAAMADTHLLIAKETDGERTKTVVRKLNEEEK
VKEIGRMISGVEMTELTKRHAKELLELAAKMKH
Download sequence
Identical sequences A0A1V9C012 G5EBC0 G8N1J9 Q6E1T0 Q6E1T4 Q75TB4 T0NXL7
WP_011231871.1.100150 WP_011231871.1.2219 WP_011231871.1.22479 WP_011231871.1.45808 WP_011231871.1.60903 WP_011231871.1.70239 WP_011231871.1.78869 WP_011231871.1.8599 WP_011231871.1.90668 gi|375009469|ref|YP_004983102.1| 235909.GK2389 gi|56420924|ref|YP_148242.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]