SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420943|ref|YP_148261.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420943|ref|YP_148261.1|
Domain Number 1 Region: 33-260
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-21
Family RecA protein-like (ATPase-domain) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56420943|ref|YP_148261.1|
Sequence length 306
Comment stage III sporulation protein AA [Geobacillus kaustophilus HTA426]
Sequence
MEAVWGILPKTVAAALQHHLPSCRRGIEEIRIRVSRPLEVIVDGTARLLPYEVTKEDGVH
LLNKLSHYSIYAVEEELKRGFMTIEGGHRVGLAGKVITEGGKVKAIRDVSSFNIRIAKEQ
IGIAEPLIPYVYDGRWRHTMIIGSPQTGKTTLLRDAARLISSGTRRIPAQKVAIVDERSE
IAGCVKGIPQFSFGPRLDVLDACPKAEGMMMMIRSMSPDVMIVDEIGREEDSEAVLEAAN
AGVSVWTTVHGRNIQDVWQRPTLGPVMEQKVFERFIELTNIPHPGSIRRILDAGGTVLYE
RAVVHR
Download sequence
Identical sequences A0A063YSF7 A0A098L1S1 A0A1C3D9U7 A0A1V4P6B2 A0A1V9C805 A0A2H5KLA5 G8N231 L7ZU12 Q5KX93
235909.GK2408 gi|375009488|ref|YP_004983121.1| gi|448238686|ref|YP_007402744.1| gi|56420943|ref|YP_148261.1| WP_011231890.1.17728 WP_011231890.1.19233 WP_011231890.1.2219 WP_011231890.1.22479 WP_011231890.1.3446 WP_011231890.1.38928 WP_011231890.1.45808 WP_011231890.1.60903 WP_011231890.1.6497 WP_011231890.1.70239 WP_011231890.1.78869 WP_011231890.1.8599 WP_011231890.1.90668 WP_011231890.1.91533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]