SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420970|ref|YP_148288.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420970|ref|YP_148288.1|
Domain Number 1 Region: 4-307
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.37e-71
Family RecA protein-like (ATPase-domain) 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56420970|ref|YP_148288.1|
Sequence length 357
Comment DNA transport protein [Geobacillus kaustophilus HTA426]
Sequence
MLNEIEQTANRLLAEAVQRRASDLHLVPRRRDAAVRLRLDGMLVDVGVLSKETAERLIAH
FKFLAGMDIGERRRPQSGAMEVAEFGETVYLRLSTLPTLYDESLVIRLLPQRFSLPLREL
SLFFRSTARLFSFMQHPQGLVLLTGPTGSGKTTTLYTLLDLCQAERQRNIITLEDPIEKQ
NERLLQVQINEKAGITYAAGLKAALRHDPDVLMVGEIRDHDTAAIAIRSALSGHLVVSTM
HAADAVGAVYRLHEFGIPLGDLAETLLAVSAQRLVELCCPLCGDDCHPSCGRLGRRRRTA
VYELLCGSALEDVIRSLSNGRGKPKRSYMTLARLIRKGIALGYLPVRMLELVGGGER
Download sequence
Identical sequences A0A087LE56 A0A098L1P1 A0A0G3Y0V5 A0A161XP88 G8N261 Q5KX66 U2X2R8
235909.GK2435 gi|56420970|ref|YP_148288.1| WP_011231917.1.14676 WP_011231917.1.20351 WP_011231917.1.2219 WP_011231917.1.30801 WP_011231917.1.38513 WP_011231917.1.44827 WP_011231917.1.46681 WP_011231917.1.56669 WP_011231917.1.58461 WP_011231917.1.59290 WP_011231917.1.60903 WP_011231917.1.62042 WP_011231917.1.78869 WP_011231917.1.8599 WP_011231917.1.93593 gi|375009518|ref|YP_004983151.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]