SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421006|ref|YP_148324.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421006|ref|YP_148324.1|
Domain Number 1 Region: 5-228
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.49e-60
Family ABC transporter ATPase domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56421006|ref|YP_148324.1|
Sequence length 255
Comment metal (zinc) ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MENGLVVQIEDVSFRYENENVLEHVSLTVPKGAFLGLVGPNGSGKSTLLKCVLGLLKPNS
GRIFLFGEPIESFREWHRIGFVSQKANSFNRSFPATVEEVAASGLAAKRGLFRPLTHEDR
RAVEAALAAVGLSGLAKRNIAELSGGQQQRVFIARALASKPDLLILDEPTVGVDARHVHE
FYELLGDLNRRGLTLILVTHDIGTITDRVTDIACLNKRLYFHGKAEEFEHLGNEAISQFY
GHPLHVLSHEHERAE
Download sequence
Identical sequences A0A063YPE8 A0A098L058 A0A1C3D6F4 A0A1V9CSY2 A0A2H5KL43 G8N299 Q5KX30 S7T0R0 T0PYN0 U2WP40 V6V951
gi|375009556|ref|YP_004983189.1| gi|56421006|ref|YP_148324.1| WP_011231951.1.100150 WP_011231951.1.19233 WP_011231951.1.2219 WP_011231951.1.22479 WP_011231951.1.25743 WP_011231951.1.38928 WP_011231951.1.45808 WP_011231951.1.60903 WP_011231951.1.6497 WP_011231951.1.70239 WP_011231951.1.78869 WP_011231951.1.8599 WP_011231951.1.90668 WP_011231951.1.91533 WP_011231951.1.92435 WP_011231951.1.93593 235909.GK2471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]