SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421010|ref|YP_148328.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421010|ref|YP_148328.1|
Domain Number 1 Region: 73-361
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3e-64
Family Tandem AAA-ATPase domain 0.000000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56421010|ref|YP_148328.1|
Sequence length 436
Comment ATP-dependent RNA helicase [Geobacillus kaustophilus HTA426]
Sequence
MTETQFTRFSFQPFIIEAIKTLRFYKPTEIQERIIPGALRGESMVGQSQTGTGKTHAYLL
PIIEKIKPERAEVQAVITAPTRELATQIYHETLKITKFCPKDRMIVARCLIGGTDKQKAL
EKLNVQPHIVIGTPGRINDFIREQALDVHTAHILVVDEADLMLDMGFITDVDQIAARMPK
DLQMLVFSATIPEKLKPFLKKYMENPTFVHVDPKRTANQNIEHVLIPLRGREKTKLLRDV
LLSYNPYLAIVFVNTRKMADEVADRLAEQGLKVGVLHGDLTPRERRKMMNLIRDLEFQYV
VATDLAARGIDIEGVSHVINYELPDDLQFYIHRAGRTARAGYSGIAATIYEPSDQDAIAR
LEKMGISFVHRDLVRGEWKELPPWNRRSKRAGEKDDELALLFAKLKKTKQVKPGYKKKLR
AELEKKKKRLGRFKKS
Download sequence
Identical sequences A0A098L040 A0A1C3D6E3 G8N2Q1 Q5KX26 U2X1R9
gi|56421010|ref|YP_148328.1| WP_011231955.1.2219 WP_011231955.1.22479 WP_011231955.1.78869 WP_011231955.1.8599 WP_011231955.1.93593 gi|375009560|ref|YP_004983193.1| 235909.GK2475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]