SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421023|ref|YP_148341.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421023|ref|YP_148341.1|
Domain Number 1 Region: 11-206
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.21e-53
Family G proteins 0.0000774
Further Details:      
 
Domain Number 2 Region: 181-298
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.9e-42
Family Prokaryotic type KH domain (KH-domain type II) 0.0000684
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56421023|ref|YP_148341.1|
Sequence length 302
Comment GTP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MRKEGYKSGFVAIIGRPNVGKSTFLNRVIGQKIAIMSDKPQTTRNKIQGVYTDDDAQIIF
IDTPGVHKPKHKLGDFMMKVALNALREVDLILFMVNAEEGFGRGEAFIIERLKEVDTPVF
LVINKIDRVHPDELLPLIDRYKDLYPFAEIVPISALEGNNVDRLLEQIKERLPEGPQYYP
PDQITDHPEQFIIAELIREKALHLTREEVPHSIAVVVERIERREGSPTVYISAVIVVERD
SQKGIIIGKQGRMLKEIGQRARADIEALLGSRVFLELWVKVQKDWRNRLSQLRDFGFRED
EY
Download sequence
Identical sequences A0A063YRA6 A0A1D7NDF0 A0A1V9BWP8 A0A2H5KL21 Q5KX13 T0NXA8 V6V9F9
WP_011231968.1.100150 WP_011231968.1.19233 WP_011231968.1.2219 WP_011231968.1.25743 WP_011231968.1.45808 WP_011231968.1.60903 WP_011231968.1.6497 WP_011231968.1.70239 WP_011231968.1.90668 gka001002488.1 235909.GK2488 gi|56421023|ref|YP_148341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]