SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421043|ref|YP_148361.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421043|ref|YP_148361.1|
Domain Number 1 Region: 6-212
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.31e-57
Family G proteins 0.00019
Further Details:      
 
Domain Number 2 Region: 175-297
Classification Level Classification E-value
Superfamily Translation proteins 1.06e-36
Family Elongation factors 0.0014
Further Details:      
 
Domain Number 3 Region: 408-503
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.76e-28
Family EF-G/eEF-2 domains III and V 0.011
Further Details:      
 
Domain Number 4 Region: 301-379
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.69e-19
Family EF-G/eEF-2 domains III and V 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56421043|ref|YP_148361.1|
Sequence length 609
Comment GTP-binding protein LepA [Geobacillus kaustophilus HTA426]
Sequence
MNREERLKRQERIRNFSIIAHIDHGKSTLADRILEKTGALSERELREQTLDTMELERERG
ITIKLNAVQLTYKAKNGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQ
TLANVYLAIDNNLEILPVINKIDLPSAEPERVRQEIEDVIGLDASDAVLASAKVGIGIEE
ILEKIVEKIPAPSGDPDAPLKALIFDSLYDPYRGVVAYVRVVDGTVKPGQRIKMMSTGKE
FEVTEVGVFTPKQKVVDELTVGDVGYLTASIKNVKDTRVGDTITDAERPAAEPLPGYRKL
NPMVFCGMYPIDTARYNDLREALEKLQLNDAALHFEPETSQALGFGFRCGFLGLLHMEII
QERLEREFHIDLITTAPSVVYKVHLTDGTEVDVDNPTNMPDPQKIDRIEEPYVKATIMVP
NDYVGPVMELCQGKRGTFVDMQYLDEKRVMLIYDIPLSEIVYDFFDALKSNTKGYASFDY
ELIGYRPSNLVKMDILLNGEKIDALSFIVHRDSAYERGKAIVEKLKDLIPRQQFEVPVQA
AIGNKVIARSTIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMA
VLKIDDQKK
Download sequence
Identical sequences A0A063YLU1 A0A098L1E6 A0A0K2H5X4 A0A1C3D6H5 A0A1Q5STT5 A0A1V4P672 A0A1V9C7P1 A0A2H5KL01 G8N2T7 Q5KWZ3 T0NS70 U2X1U7
gi|56421043|ref|YP_148361.1| 235909.GK2508 gi|375009596|ref|YP_004983229.1| WP_011231987.1.100150 WP_011231987.1.19233 WP_011231987.1.2219 WP_011231987.1.22479 WP_011231987.1.3446 WP_011231987.1.38928 WP_011231987.1.45808 WP_011231987.1.59104 WP_011231987.1.60903 WP_011231987.1.6497 WP_011231987.1.70239 WP_011231987.1.77642 WP_011231987.1.78869 WP_011231987.1.8599 WP_011231987.1.90668 WP_011231987.1.91533 WP_011231987.1.93593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]