SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421048|ref|YP_148366.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421048|ref|YP_148366.1|
Domain Number 1 Region: 12-213
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-29
Family Extended AAA-ATPase domain 0.0073
Further Details:      
 
Domain Number 2 Region: 217-334
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 3.06e-22
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56421048|ref|YP_148366.1|
Sequence length 348
Comment DNA polymerase III subunit delta [Geobacillus kaustophilus HTA426]
Sequence
MLERVWGNIEKRRFSLLYLLYGNEPFLLTETYERLVNAALGPEEREWNLAVYDCEETPVE
AALEEAETVPFFGERRVILIKHPYFFTSEKEKEIEHDLAKLEAYLKAPSPFSIVVFFAPY
EKLDERKKITKLAKEQSEVVIAAPLAEAELRAWVRRRIESQGAQASDEAIDVLLRRAGTQ
LSALANEIDKLALFAGSGGTIEAAAVERLVARTPEENVFVLVEQVAKRDIPAALQTFYDL
LENNEEPIKILALLAAHFRLLSQVKWLASLGYGQAQIAAALKVHPFRVKLALAQAARFAD
GELAEAINELADADYEVKSGAVDRRLAVELLLMRWGTRPAQAGRHGRR
Download sequence
Identical sequences A0A063YP10 A0A1C3D708 A0A1V9BWP0 L8A0Q8 Q5KWY8 U2WP88 V6V9D4
235909.GK2513 gi|56421048|ref|YP_148366.1| gi|448238792|ref|YP_007402850.1| WP_011231992.1.17728 WP_011231992.1.19233 WP_011231992.1.2219 WP_011231992.1.22479 WP_011231992.1.25743 WP_011231992.1.45808 WP_011231992.1.6497 WP_011231992.1.70239 WP_011231992.1.93593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]