SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421060|ref|YP_148378.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421060|ref|YP_148378.1|
Domain Number 1 Region: 63-281
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.64e-32
Family G proteins 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56421060|ref|YP_148378.1|
Sequence length 369
Comment GTP-binding protein YqeH [Geobacillus kaustophilus HTA426]
Sequence
MEPQLRCIGCGAAIQFDDPKKAGYAPKSVLEKDEEEIICQRCFRLKHYNEVQDVPLDDSD
FLNMLHRIGESKALVVNIVDIFDFNGSWIPGLPRFAAENPILLVGNKADLLPRSVKYPKL
LRWMRRMAEELGLRPVDVCLVSAAKGIGMAKVMEAINRYREGGDVYVVGCTNVGKSTFIN
RIIEEATGKGNVITTSYFPGTTLDMIEIPLEGGATLYDTPGIINHHQMAHFVDARDLKII
TPKREIHPRVYQLNEGQTLFFGGLARLDYIKGGRRSFVCYMANELTVHRTKLEKADSLYA
NQLGDLLSPPNKRYAAEFPPLVPRSLSVKERKTDIVFSGLGWVTCNDPGAQLVVHAPKGV
DVFIRQSLI
Download sequence
Identical sequences A0A1C3D754 A0A1V9BWQ8 A0A2H5KMJ6 G8N2V6 Q5KWX6 U2Y0S6
gi|375009615|ref|YP_004983248.1| 235909.GK2525 WP_011232004.1.100150 WP_011232004.1.2219 WP_011232004.1.22479 WP_011232004.1.25743 WP_011232004.1.45808 WP_011232004.1.60903 WP_011232004.1.6497 WP_011232004.1.70239 WP_011232004.1.78869 WP_011232004.1.8599 WP_011232004.1.90668 WP_011232004.1.91533 WP_011232004.1.93593 gi|56421060|ref|YP_148378.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]