SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421096|ref|YP_148414.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421096|ref|YP_148414.1|
Domain Number 1 Region: 336-734
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.48e-59
Family Tandem AAA-ATPase domain 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|56421096|ref|YP_148414.1|
Domain Number - Region: 94-155
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000297
Family Hef domain-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56421096|ref|YP_148414.1|
Sequence length 786
Comment ATP-dependent exonuclease V [Geobacillus kaustophilus HTA426]
Sequence
MQEQQILALDGRTFIKGVCLAVIFHNEETLYTVVRVRVEETNEAPVEEEVVVTGYFPRLN
EGDVYIFYGQFRQHPRFGRQYAASQFRKQLPNTKEGVIHYLSSGLFKGIGKKTAAAIVET
LGENAIAAILRDPRALERVPKLTKKKAKQLYDALRAHEGLEQTMIALAQLGFGPQLAMKI
YQAYGEEAVDIIHENPYQLVEDIEGIGFGRADEIGRQLGISGSHPARLRAASLFVLEQAC
LQEGHVYLREEELMERIGELLDGRLSGAVDGRAISQTLLMLSEEGKLIAEQGRYYLPSLY
FAEKGIVSNIKRLLGQTPPSAFAESEFLLALGALEERLGMQYAPQQREAIQQALSSPLFI
LTGGPGTGKTTVIKGIVELFAALNGLSLDPADYKQGEPFPVLLAAPTGRAAKRMSEATGL
PAATIHRLLGWNGAEGFSRDENEPISGKLLVIDEMSMVDTWLANQLLKAVPNGMQVIFVG
DEDQLPSVGPGQVLKDLLSSGVIPFARLTEVYRQAEGSSIIELAHEMKRGVVPDDLTAPK
ADRSFIRCRAGQVVDVVRQIADNARKKGFSVKDIQVLAPMYRGPAGIDQLNKALQELFNP
PAEGKRELSVGEVVYRVGDKVLQLVNQPEDNVFNGDIGEIVAIFYAKENIEKQDLLVVSF
DGIEVTYTRQDLGQITHAYCCSVHKAQGSEFPIVILPVVKSYYRMLKRNLLYTAVTRSKQ
FLVLCGEEEAFRFGVAKQSDGARQTALAEKLAGAAAPFVEVELPFEEANMGMENVTPYDF
MGDEPS
Download sequence
Identical sequences A0A2H5KKT1 Q5KWU0
gi|56421096|ref|YP_148414.1| WP_011232038.1.2219 WP_011232038.1.25743 WP_011232038.1.60903 WP_011232038.1.90668 WP_011232038.1.93593 235909.GK2561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]