SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421126|ref|YP_148444.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421126|ref|YP_148444.1|
Domain Number 1 Region: 21-255
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.17e-56
Family Extended AAA-ATPase domain 0.000000175
Further Details:      
 
Domain Number 2 Region: 257-331
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.78e-26
Family Helicase DNA-binding domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56421126|ref|YP_148444.1|
Sequence length 333
Comment Holliday junction DNA helicase RuvB [Geobacillus kaustophilus HTA426]
Sequence
MEERLVSGEVLGEETALEPSLRPQYLHEYIGQDKIKENLKVFIEAAKLREETLDHVLLYG
PPGLGKTTLAVIIANEMGVKLRATSGPALERPGDLAALLTSLEPGDVLFIDEIHRLPRAV
EEVLYPAMEDYCLDITIGKGPDARTLRLDLPPFTLVGATTRAGALSAPLRDRFGVISRLE
YYHVDQLAQIIERAAAILQIGIEREAALELARRARGTPRIANRLLRRVRDFAQVRGEGGI
TLPLAVEALERLQVDRLGLDQIDHKLLSAMIEKFAGGPVGLETLAAVIGEEAQTIEEVYE
PYLMQIGLLQRTPRGRVVTPAAYTHLGMEVPKR
Download sequence
Identical sequences A0A2H5KKQ0 Q5KWR0 V6VFB8
235909.GK2591 WP_011232067.1.2219 WP_011232067.1.25743 WP_011232067.1.90668 gi|56421126|ref|YP_148444.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]