SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421148|ref|YP_148466.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421148|ref|YP_148466.1|
Domain Number 1 Region: 3-264
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.88e-62
Family Nitrogenase iron protein-like 0.0000493
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56421148|ref|YP_148466.1|
Sequence length 267
Comment chromosome partitioning ATPase [Geobacillus kaustophilus HTA426]
Sequence
MGEAIVITSGKGGVGKTTTTANLGTALAILGKRVCLVDTDIGLRNLDVVLGLENRIIYDL
VDVVEGRCTVQKALVKDKRFDNHLYLLPAAQTSDKSAVNPAQMKQLIEELKQEYDYVLID
CPAGIEQGYRNAVAGADEAIVVTTPEVSAVRDADRIIGLLEAEEHVKPPRLIINRIRSHM
VKNGDMLDVDEIISHLSIELLGIIADDENVIKASNRGEPIVLDPNSKASIAFRNIARRIL
GESVPLPPLEEEEKGLFSKIRKIFSLK
Download sequence
Identical sequences A0A063YQK5 A0A1C3D4C3 A0A1V9C8U4 A0A2H5KKM9 Q5KWN8 T0NW49 V6VE97
gi|56421148|ref|YP_148466.1| 235909.GK2613 WP_011232089.1.100150 WP_011232089.1.19233 WP_011232089.1.2219 WP_011232089.1.22479 WP_011232089.1.25743 WP_011232089.1.38928 WP_011232089.1.45808 WP_011232089.1.60903 WP_011232089.1.72400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]