SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421187|ref|YP_148505.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421187|ref|YP_148505.1|
Domain Number 1 Region: 59-397
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.09e-80
Family Extended AAA-ATPase domain 0.00000000648
Further Details:      
 
Domain Number 2 Region: 11-46
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000171
Family ClpX chaperone zinc binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56421187|ref|YP_148505.1|
Sequence length 421
Comment ATP-dependent protease ATP-binding subunit ClpX [Geobacillus kaustophilus HTA426]
Sequence
MFKFNDEKGQLKCSFCGKTQDQVRKLVAGPGVYICDECIELCTEIVEEELGNEEEFEFKD
VPKPLEIREILDEYVIGQDEAKKSLAVAVYNHYKRINSGSKIDDVELSKSNILMIGPTGS
GKTLLAQTLARILNVPFAIADATSLTEAGYVGEDVENILLKLIQAADYDVERAEKGIIYI
DEIDKIARKSENPSITRDVSGEGVQQALLKILEGTIASVPPQGGRKHPHQEFIQIDTTNI
LFICGGAFDGIEPIIKRRLGKKVIGFGAEMNQTDVDEKNLLSKVLPEDLLKFGLIPEFIG
RLPVITTLEPLDEQALIDILTKPKNAIVKQYQKMLELDGVELEFEEAALREIAKKAIERK
TGARGLRSIIEGIMLDVMFELPSREDVQKCIITLDTVRGTKPPTLIRHDGTVIELERKTS
A
Download sequence
Identical sequences A0A063YNY5 A0A0E0TF69 A0A0J0V6M4 A0A0K2H788 A0A0N0I955 A0A142D2U7 A0A1C3D4D2 A0A1Q5TAA7 A0A1V4PCK4 A0A1V9BZ62 A0A2H5KKJ4 G8N461 L8A2F6 Q5KWJ9 T0Q0W8 U2X131 V6VLV4
235909.GK2652 544556.GYMC61_0865 gi|375009750|ref|YP_004983383.1| gi|319767709|ref|YP_004133210.1| gi|56421187|ref|YP_148505.1| gi|448238934|ref|YP_007402992.1| WP_011232128.1.100150 WP_011232128.1.17728 WP_011232128.1.19233 WP_011232128.1.20723 WP_011232128.1.2219 WP_011232128.1.22479 WP_011232128.1.25743 WP_011232128.1.25789 WP_011232128.1.3446 WP_011232128.1.38928 WP_011232128.1.46340 WP_011232128.1.50933 WP_011232128.1.57889 WP_011232128.1.59104 WP_011232128.1.60903 WP_011232128.1.6497 WP_011232128.1.65208 WP_011232128.1.70239 WP_011232128.1.77642 WP_011232128.1.78869 WP_011232128.1.80994 WP_011232128.1.8599 WP_011232128.1.86012 WP_011232128.1.90668 WP_011232128.1.91533 WP_011232128.1.9165 WP_011232128.1.92435 WP_011232128.1.93593 gi|261418332|ref|YP_003252014.1| gi|297529184|ref|YP_003670459.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]