SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421351|ref|YP_148669.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421351|ref|YP_148669.1|
Domain Number 1 Region: 395-684
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-47
Family RecA protein-like (ATPase-domain) 0.052
Further Details:      
 
Domain Number 2 Region: 710-776
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.21e-23
Family FtsK C-terminal domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56421351|ref|YP_148669.1|
Sequence length 784
Comment DNA translocase [Geobacillus kaustophilus HTA426]
Sequence
MKFWKRWLRFLTSDEEEEGNEQRANSRLSAGMPERGAVNVIYQYPQGRFRFPLIPDDQPG
ENQERPRREKSEASRPLPSRRPSAGVSREIAEKRPFRPSDVPSPVFGYDRNRGKQRQRAD
EPELTGAGDIENRSDEAVREEALRGEATRRDAREGTESRAAEPPKEEAPLAKGAEEWNED
ASGAMPAAVMETEGKHELAPAAGQEEHDAEADEKKGQELDERGNERAPHATDGGLESEGR
GVPSQMRNGDGGSASSTEQRETTPDREIRHSAAPAGREEASRPERTRIPYNVIMLKQDWR
KLEEKAANRSNGCVLPPLALLEPPEKAAERDEQWLRDQCQRLDRTFASFHIGAKVVGATQ
GPTVTRFEVQPDLGVKVSKITSLIDDIKLSLAAKDIRIEAPIPGKRTIGIEVPNRTSRPV
RLREILESEAFRKSPSPLTVALGLDISGAPVVTDIRKMPHGLIAGATGSGKSVCMNAMLI
SMLYKAAPHEVKWLLIDPKMVELAPYNGLPHLLSPVITEAKAAAGALKWAVGEMERRYEQ
FVHAGVRDIEKYNAHLRERGSSEPPLPYIVIVIDELADLMMAAPADVEESICRLAQKARA
CGIHLLIATQRPSVDVLTGLIKANIPTRIAFSVSSQVDSRTILDVNGAERLLGRGDMLFL
ENGSAKPVRLQGCFISDEEIERVAAHVKEKQGPSYLFDPDDFRQTASMGGEDDELFEEAC
RFVIAQGGASTSSLQRHFRIGYNRAARLIEMMEERGLISEARGSKPRDVLMSEDEWERWR
EQNS
Download sequence
Identical sequences A0A098L0F3 A0A1V9BXI3 Q5KW35
WP_011232290.1.2219 WP_011232290.1.45808 WP_011232290.1.70239 WP_011232290.1.78869 235909.GK2816 gi|56421351|ref|YP_148669.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]