SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421511|ref|YP_148829.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421511|ref|YP_148829.1|
Domain Number 1 Region: 2-233
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.33e-63
Family ABC transporter ATPase domain-like 0.000000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56421511|ref|YP_148829.1|
Sequence length 235
Comment branched-chain amino acid ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MLKVDGIDVFYGNIHALKGVSLEVNKGEIVTLIGANGAGKTTLLKTISGLLRPKNGDIVY
EGASIAGKAAQTIVKQGISHVPEGRRVFANMTVEENLELGAFLRKDKEGIQQDFAKVFQL
FPRLEERRKQLAGTLSGGEQQMLAIGRALMARPKLLLLDEPSMGLAPLLVKTIFRIIQEI
NESGTTILLVEQNAHMALSIAHRAYVLESGRVVLSGTASELQASEQVKQAYLGGH
Download sequence
Identical sequences A0A098KYM8 A0A0E0TGB5 A0A0K2H869 A0A1D7NEN3 A0A1V9BU50 A0A2H5KJP4 Q5KVM5 U2X2A9 V6VHW3
235909.GK2976 544556.GYMC61_3053 WP_011232446.1.20723 WP_011232446.1.2219 WP_011232446.1.25743 WP_011232446.1.38928 WP_011232446.1.50933 WP_011232446.1.59104 WP_011232446.1.60903 WP_011232446.1.6497 WP_011232446.1.70239 WP_011232446.1.78869 WP_011232446.1.80994 WP_011232446.1.90668 WP_011232446.1.92435 WP_011232446.1.93593 gi|319768079|ref|YP_004133580.1| gi|56421511|ref|YP_148829.1| gka001002976.1 gi|261420413|ref|YP_003254095.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]