SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421512|ref|YP_148830.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421512|ref|YP_148830.1|
Domain Number 1 Region: 6-256
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.13e-66
Family ABC transporter ATPase domain-like 0.0000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56421512|ref|YP_148830.1|
Sequence length 259
Comment branched-chain amino acid ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MAAKTPLLKAENVGIQFGGLKALSGVTMELYQGELVGLIGPNGAGKTTLFNLLTGVYVPT
DGRIMLDGETLNGLPPYKITRKGISRTFQNIRLFGELSVLDNVKVAYHAHARHSIASSIL
RLPSHFRGEKEMEEKAIEFLNIFQLDGVMHEKAKNLPYGQQRRLEIARALAAQPKVLLLD
EPAAGMNPQETKELMKLIAFIRERFALTILLIEHDMSLVMGICERIYVLDHGQLIAEGTP
EQVRSNPKVIEAYLGEEVS
Download sequence
Identical sequences A0A098KYM3 A0A1C3DAW2 A0A1V9BUN6 A0A2H5KJN9 G8N6X5 Q5KVM4 V6VCW7
gi|375010101|ref|YP_004983734.1| 235909.GK2977 gi|56421512|ref|YP_148830.1| WP_011232447.1.20723 WP_011232447.1.2219 WP_011232447.1.22479 WP_011232447.1.25743 WP_011232447.1.60903 WP_011232447.1.6497 WP_011232447.1.70239 WP_011232447.1.78869 WP_011232447.1.8599 WP_011232447.1.90668 WP_011232447.1.91533 WP_011232447.1.93593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]