SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421534|ref|YP_148852.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421534|ref|YP_148852.1|
Domain Number 1 Region: 1-240
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.41e-87
Family ABC transporter ATPase domain-like 0.000000198
Further Details:      
 
Domain Number 2 Region: 249-340
Classification Level Classification E-value
Superfamily ACT-like 3.32e-23
Family NIL domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56421534|ref|YP_148852.1|
Sequence length 342
Comment ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MITLEQVTKIYQAANGSVTAVDNVSLEIREGEIFGIIGYSGAGKSTLIRLLNGLEKPTSG
RVVVAGRDMTRVKGRELRKARQEIGMIFQHFNLLWSRTVRENIAFPLEIAGVPKEERNKR
VDELIELVGLSGREDAYPSQLSGGQKQRVGIARALANNPKVLLCDEATSALDPQTTDAIL
DLLVDINKRLGLTIVLITHEMHVIRKICDRVAVMESGRIVEQGEVLHVFRNPQQPITKRF
VKQLIEPEETEEAISHLFGQYPSGLIAQLTFVGAAAGKPLITEVVRQFAVDVNILQGKIS
QTHQGAYGVLFVHLDGARDEIDRALDYIQRQQVAVEVIHDAR
Download sequence
Identical sequences A0A098KZV4 A0A1C3DAM7 A0A1Q5SK46 A0A1V9C9F4 A0A2H5KJL6 G8N7G2 Q5KVK2 U2X286 V6VG45
gi|375010127|ref|YP_004983760.1| gi|297528860|ref|YP_003670135.1| WP_011232469.1.20723 WP_011232469.1.2219 WP_011232469.1.22479 WP_011232469.1.25743 WP_011232469.1.38928 WP_011232469.1.46340 WP_011232469.1.6497 WP_011232469.1.77642 WP_011232469.1.78869 WP_011232469.1.8599 WP_011232469.1.90668 WP_011232469.1.91533 WP_011232469.1.92435 WP_011232469.1.93593 235909.GK2999 gi|56421534|ref|YP_148852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]