SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421601|ref|YP_148919.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421601|ref|YP_148919.1|
Domain Number 1 Region: 12-162
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000171
Family Adenosine-5'phosphosulfate kinase (APS kinase) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56421601|ref|YP_148919.1|
Sequence length 298
Comment hypothetical protein GK3066 [Geobacillus kaustophilus HTA426]
Sequence
MGQNGALQPIQLVIITGMSGAGKTVAIQSFEDLGFFCIDNLPPTLLPKFLELVKESGNKM
NKVALVMDLRSRDFFDHLFAALDELAEQAWVIPQVLFLDAQDSTLVARYKETRRTHPLAP
NEPPLEGIRLERKLLEELKGRAQIIYDTTGLKPRELREKIIRQFSSHAQSGFTINVMSFG
FKYGIPIDADLVFDVRFLPNPHYIEHMRPKTGLDDDVSSYVLKWGETQKFLEKLIDLLSF
MLPYYQREGKSQLVIAIGCTGGQHRSVALAEYIARHFSDDYKTVVSHRDMERRKDIHR
Download sequence
Identical sequences A0A063YQV7 A0A098KZN8 A0A1C3D9W2 A0A1V9BRM6 A0A2H5KJF0 G8MX11 Q5KVD5 U2WVL4 V6VKT6
WP_011232536.1.19233 WP_011232536.1.2219 WP_011232536.1.22479 WP_011232536.1.25743 WP_011232536.1.6497 WP_011232536.1.70239 WP_011232536.1.78869 WP_011232536.1.8599 WP_011232536.1.90668 WP_011232536.1.91533 WP_011232536.1.93593 gi|56421601|ref|YP_148919.1| gi|375010201|ref|YP_004983834.1| 235909.GK3066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]