SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421620|ref|YP_148938.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421620|ref|YP_148938.1|
Domain Number 1 Region: 616-909
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.5e-55
Family ABC transporter ATPase domain-like 0.0061
Further Details:      
 
Domain Number 2 Region: 12-207,431-570
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.57e-48
Family ABC transporter ATPase domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56421620|ref|YP_148938.1|
Sequence length 955
Comment excinuclease ABC subunit A [Geobacillus kaustophilus HTA426]
Sequence
MNGMDKIVVKGARAHNLKNIDVEIPRGKLVVLTGLSGSGKSSLAFDTIYAEGQRRYVESL
SAYARQFLGQMEKPDVDAIEGLSPAISIDQKTTSRNPRSTVGTVTEIYDYLRLLFARIGR
PICPTHGIEIQSQTIEQMVDRLLAYPERTKMQILAPIVSGKKGTHAKTLEDIRKQGYVRV
RIDGEMRELTEDIELEKNKKHSIDVVVDRIIIKDGIAARLADSLETALKLADGKVVVDVI
GEGELLFSEKHACPYCGFSIGELEPRLFSFNSPFGACPDCDGLGAKLEVDLDLVIPNDEL
TLKEHAIAPWEPQSSQYYPQLLEAVCRHYGIPMDVPVRDLPKEQLDKILYGSGGEPIYFR
YTNDFGQVREQYIAFEGVIPNVERRYRETSSDYIREQMEKYMAEQPCPTCQGYRLKKESL
AVLVGGKHIGEVTAMSVTEALAFFDGLELTEKEAQIARLILREIRDRLGFLQNVGLDYLT
LSRSAGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLIATLKSMRDLGN
TLIVVEHDEDTMLAADYLIDIGPGAGIHGGEVVAAGTPEEVMNDPNSLTGQYLSGKKFIP
IPAERRRPDGRWLEVVGAREHNLKNVSVKIPLGTFVAVTGVSGSGKSTLVNEVLYKALAQ
KLHRAKAKPGEHRGIRGLEHLDKVIDIDQSPIGRTPRSNPATYTGVFDDIRDVFASTNEA
KVRGYKKGRFSFNVKGGRCEACHGDGIIKIEMHFLPDVYVPCEVCHGKRYNRETLEVTYK
GKNIAEVLDMTVEDALDFFASIPKIKRKLETLYDVGLGYMKLGQPATTLSGGEAQRVKLA
AELHRRSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIKTADYI
IDLGPEGGDRGGQIVAVGTPEEVAEVEESHTGRYLKPILERDRARMQAQYEAVKA
Download sequence
Identical sequences A0A098L0Y8 Q5KVB6
235909.GK3085 WP_011232555.1.2219 WP_011232555.1.78869 WP_011232555.1.91533 gi|56421620|ref|YP_148938.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]