SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421621|ref|YP_148939.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421621|ref|YP_148939.1|
Domain Number 1 Region: 5-414
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.44e-148
Family Tandem AAA-ATPase domain 0.000000000000376
Further Details:      
 
Domain Number 2 Region: 36-82,458-572
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.4e-37
Family Tandem AAA-ATPase domain 0.000000147
Further Details:      
 
Domain Number 3 Region: 612-656
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.0000000000667
Family C-terminal UvrC-binding domain of UvrB 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56421621|ref|YP_148939.1|
Sequence length 658
Comment excinuclease ABC subunit B [Geobacillus kaustophilus HTA426]
Sequence
MEGRFQLVAPYEPQGDQPQAIAKLVDGLRRGVKHQTLLGATGTGKTFTISNVIAQVNKPT
LVIAHNKTLAGQLYSELKEFFPHNAVEYFVSYYDYYQPEAYVPQTDTYIEKDAKINDEID
KLRHSATSALFERRDVIIVASVSCIYGLGSPEEYRELVVSLRVGMEIERNALLRRLVDIQ
YDRNDIDFRRGTFRVRGDVVEIFPASRDEHCIRVEFFGDEIERIREVDALTGEVLGEREH
VAIFPASHFVTREEKMRLAIQNIEQELEERLAELRAQGKLLEAQRLEQRTRYDLEMMREM
GFCSGIENYSRHLALRPPGSTPYTLLDYFPDDFLIIVDESHVTLPQLRGMYNGDRARKQV
LVDHGFRLPSALDNRPLTFEEFEQKINQIIYVSATPGPYELEHSPGVVEQIIRPTGLLDP
TIDVRPTKGQIDDLIGEIRERVERNERTLVTTLTKKMAEDLTDYLKEAGIKVAYLHSEIK
TLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGR
AARNANGHVIMYADTITKSMEVAIQETKRRRAIQEEYNRKHGIVPRTVKKEIRDVIRATY
AAEETEMYEAKPAAAMTKQEREELIRTLEAEMKEAAKALDFERAAQLRDIIFELKAEG
Download sequence
Identical sequences A0A1C3D935 A0A1V9BYQ7 G8MX38 Q5KVB5
235909.GK3086 gi|375010228|ref|YP_004983861.1| gi|56421621|ref|YP_148939.1| WP_011232556.1.2219 WP_011232556.1.22479 WP_011232556.1.70239 WP_011232556.1.78869 WP_011232556.1.8599 WP_011232556.1.91533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]