SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56421636|ref|YP_148954.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421636|ref|YP_148954.1|
Domain Number 1 Region: 1-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.38e-72
Family ABC transporter ATPase domain-like 0.00000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56421636|ref|YP_148954.1|
Sequence length 231
Comment cell-division ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MIEMQDVYKTYPNGVVALNGINVRIKQGEFVYVVGPSGAGKSTFIKMMYREEKPTSGTIM
VNGVNLAKLKDSKVPLLRRHIGVVFQDFKLLPKLNVYENVAFALEVIEESPKVIRKKVME
VLDLVGLKHKIRSYPNELSGGEQQRVSIARSIVNSPKIVIADEPTGNLDPETSWGIVELF
EKINDRGTTIVMATHNKEIVNATRRRVIAIENGKIVRDEAKGEYGYDASYV
Download sequence
Identical sequences A0A063YP05 A0A063YQZ6 A0A087LAL1 A0A0E0TG18 A0A0K1KAC8 A0A0K2H8I9 A0A164CDW9 A0A1C3D9T3 A0A1Q5T6Z4 A0A1V4P407 A0A1V9CFR3 A0A2H5KJB5 L8A154 Q5KVA0 V6VKQ3
WP_011232571.1.100150 WP_011232571.1.14676 WP_011232571.1.17728 WP_011232571.1.19233 WP_011232571.1.20723 WP_011232571.1.2219 WP_011232571.1.22479 WP_011232571.1.25743 WP_011232571.1.3446 WP_011232571.1.38513 WP_011232571.1.38928 WP_011232571.1.45808 WP_011232571.1.50933 WP_011232571.1.59104 WP_011232571.1.59290 WP_011232571.1.60903 WP_011232571.1.6497 WP_011232571.1.70239 WP_011232571.1.77642 WP_011232571.1.78869 WP_011232571.1.80994 WP_011232571.1.8599 WP_011232571.1.90668 WP_011232571.1.91533 WP_011232571.1.92435 WP_011232571.1.93593 gi|56421636|ref|YP_148954.1| 235909.GK3101 gi|448239358|ref|YP_007403416.1| gi|319768213|ref|YP_004133714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]