SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421642|ref|YP_148960.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421642|ref|YP_148960.1|
Domain Number 1 Region: 6-226,348-395
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.54e-86
Family Tandem AAA-ATPase domain 0.0000000126
Further Details:      
 
Domain Number 2 Region: 571-825
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 9.16e-85
Family Helical scaffold and wing domains of SecA 0.0000000402
Further Details:      
 
Domain Number 3 Region: 396-569
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-56
Family Tandem AAA-ATPase domain 0.000000137
Further Details:      
 
Domain Number 4 Region: 225-348
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 2.09e-48
Family Pre-protein crosslinking domain of SecA 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56421642|ref|YP_148960.1|
Sequence length 837
Comment preprotein translocase subunit SecA [Geobacillus kaustophilus HTA426]
Sequence
MLGVLKKVFDPNKRQLARLEKIADQVDALGPEMARLSDEQLRQKTEEFKARYQQGESLDD
LLVEAFAVVREGAKRVLGLYPYKVQIMGGVVLHEGDIAEMKTGEGKTLTATMPVYLNALT
GRGVHVVTVNEYLATRDATEMGKLYEFLGMTVGLNLSGMSREEKQAAYNADITYGTNNEF
GFDYLRDNMVLYKEHIVQRPLYYAIIDEVDSILIDEARTPLIISGTAQKSTKLYVQANAF
VRTLRKDVDYTYDEKTKSVQLTEEGINKAERAFGIDNLFDLKHVTLNHHIQLALRAHVTM
QRDVDYVVQDGKVIIVDPFTGRLMHGRRYSDGLHQAIEAKEGLEIQNESMTLATITFQNY
FRMYEKLAGMTGTAKTEEEEFRNIYNMRVVVIPTNRPVIREDRPDLIYRTMEGKFRAVVE
DIAARHAKGQPVLVGTVAIETSEMLSEMLKKRGIPHNVLNAKNHAKEAEIIAQAGQKGAV
TIATNMAGRGTDIKLGEGVKELGGLAVIGTERHESRRIDNQLRGRSGRQGDPGVSQFYLS
LEDELMRRFGSESLMAMMDRLGMDDSQPIQSKMVTRAVESAQKRVEGNNFDARKQLLQYD
DVLREQREIIYRQRYEVLDSDNLRGIIEKMIHSVIERVVNAHTPKEEVPEEWNLKGLVEY
LNAHLLPEGDVTEADLRGKEPEEMIELIWAKVKARYDEKEAQIPPEQMREFERVVVLRAV
DMKWMHHIDAMEQLRQGIHLRAYGQVDPLREYQMEGYAMFEEMIAAIEEEVATYIMKAEI
HHNLERQEVAKGEAVHPKEDGEEPKRKPVRKAVRVGRNDPCPCGSGKKYKHCCGRTV
Download sequence
Identical sequences Q5KV94
WP_011232577.1.2219 WP_011232577.1.45808 235909.GK3107 gi|56421642|ref|YP_148960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]