SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421705|ref|YP_149023.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421705|ref|YP_149023.1|
Domain Number 1 Region: 7-226,348-395
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.52e-77
Family Tandem AAA-ATPase domain 0.0000000969
Further Details:      
 
Domain Number 2 Region: 397-564
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.73e-47
Family Tandem AAA-ATPase domain 0.00000814
Further Details:      
 
Domain Number 3 Region: 575-780
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 5.23e-44
Family Helical scaffold and wing domains of SecA 0.00018
Further Details:      
 
Domain Number 4 Region: 232-348
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 7.98e-43
Family Pre-protein crosslinking domain of SecA 0.0000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56421705|ref|YP_149023.1|
Sequence length 797
Comment preprotein translocase subunit SecA [Geobacillus kaustophilus HTA426]
Sequence
MFAKVKQLFDESAREVQRLAKLAAQINEWEPTISSLSDEQLRQKTVVFKERLERGETLDD
IKIEAFAVVREAARRVLGLRHYDVQLMGGLAMHEGNIAEMQTGEGKTLAATLPSYLHALL
GKGVHIITANEYLARRDCEQMGRVFRFLGLTVGLNVSQMTASEKKEAYAADITYGTGTEF
GFDYLRDNMVYRLEDKVQRPLYYAIIDEIDSILIDEARTPLIIANKSGIGAELFPIMARI
VRTFEEGKEYERSLETKQIFLTEEGAQKIERAFGIDNLYDWEHHVLLHHAMQSLRAWFIM
RRDVDYIVKNGKVMIVDPFTGRVMEGRSFSDGLHQAIEAKEGVEITEENDIQATITIQNY
FRMYEKLAGMTGSATPSKEEFWQTYRLRVITIPTNQPSRRTDWDDLVYQTYEAKVRKIID
EVKKMNAIGRPVLIGTTSVAQSEQLSAAFSKAGIPHHLLNAKTEEEEARIIATAGQKGQV
MIATNMAGRGTDILLGEGVKELGGLHIIGTERHESHRIDMQLRGRAGRQGDPGSSQFIIS
LDDDLFRLYDQDELKKWKSKVETDETGRIVSPDPIKFVQKVQTTIENAHYSARLHLLKLD
TVIDQQSKVIYHMRDRVLALKQAEVLSELLRHIHRHITQTIDRYCPENVFFEEWNIEGLH
NELRRAFFRFAYPIDDLRHKQKEEIAQLVWDEYKSLEAALADLPCDEEQTMRLKHLMVET
IDAHWIRHLNQLNLLKEGIHLRSYGQEDPYRAFEMDAYREFVALQQAIDAGICTTAMNYL
KSQFVIDDEAAAAANKP
Download sequence
Identical sequences Q5KV31
gi|56421705|ref|YP_149023.1| 235909.GK3170 WP_011232640.1.2219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]