SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421763|ref|YP_149081.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421763|ref|YP_149081.1|
Domain Number 1 Region: 2-225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.58e-58
Family ABC transporter ATPase domain-like 0.00013
Further Details:      
 
Domain Number 2 Region: 252-478
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.72e-47
Family ABC transporter ATPase domain-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56421763|ref|YP_149081.1|
Sequence length 494
Comment ribose ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MIDMRSIQKSFGANIVLNGVDFEVLPGEVHALMGENGAGKSTLIKVLTGIYERDGGTIVV
NGREVHYRHPKEAERDGIVVIHQELNVIPTLTVAENIFLGREPKIGRTGVIRYKEMEQQA
ASYLRRLGMDLDPRELAGRLSVGKQQMIEIARAISTNAKCLIMDEPTAALTEREIQALFS
VIPTLKQQGVAVVYISHRMEEIFTICDRISVLRDGQFIGTKRVKETNFDEIVQMMVGRQI
GERFPKRRVTIGEERLRVERLTKKGLFENVSFSVRAGEVLGVAGLMGSGRTEIMEAIFGA
RPFDEGDIYIDGRPVRIRSPRQAVEHGIAMITEDRKQKGLILEMSVHENLTLPKLEQLAT
AGFIQSSKERDVVLTYIHLLNIKASSPDLPVKALSGGNQQKVVFGKWLAMNPRILILDEP
TRGVDVGAKKEIYEVINELAAQGAAIIMISSELPEVLGMSDRVMVVHEGKVQAILENDGL
DQETIMRAATGGNR
Download sequence
Identical sequences Q5KUX3
235909.GK3228 gi|56421763|ref|YP_149081.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]