SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421780|ref|YP_149098.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421780|ref|YP_149098.1|
Domain Number 1 Region: 251-371
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.81e-17
Family Universal stress protein-like 0.012
Further Details:      
 
Domain Number 2 Region: 27-137
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000193
Family RecA protein-like (ATPase-domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56421780|ref|YP_149098.1|
Sequence length 374
Comment K+-transporting ATPase d chain [Geobacillus kaustophilus HTA426]
Sequence
MNHKYRRMTPEEILKKIENMKKGRLKIYIGAAPGVGKTFHMLRDAHDVREKGIDIVIGIV
ETHGRAETEAEIKDLEIIPRKKIHYKGKEFAELDVDAVIRRNPDVVIVDELAHTNAPGSK
NKKRYQDVQEILQAGIHVWTAMNIQHLESVHDIVEQVTGVQVNERVPDFMLREADEIEVI
DITPEALRERIKEGKVYGKEKIDQALNHFFRKGNLVALRELTLREVADDIEMRLEKEREE
QGIEEPTGIHEKILVCVNYRPNAEKLIRRGWRIAQRLNAELYILHIKQKRQSPERTIAEW
EKMAKQFGATFLVREAASRRVAHQIVDVCREYKITQIVMGMSARTRWEEIWKGSLINVIM
QQLKHVDVLVVSDR
Download sequence
Identical sequences A0A063YKK1 A0A087LH10 A0A0K1KBJ2 A0A1C3D536 A0A1V4P1K4 A0A1V9BNB9 A0A223DW31 Q5KUV6
WP_011232715.1.19233 WP_011232715.1.2219 WP_011232715.1.22479 WP_011232715.1.26402 WP_011232715.1.3446 WP_011232715.1.38513 WP_011232715.1.45808 WP_011232715.1.59290 WP_011232715.1.65208 WP_011232715.1.70239 WP_011232715.1.78869 WP_011232715.1.86012 235909.GK3245 gi|56421780|ref|YP_149098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]