SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421803|ref|YP_149121.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421803|ref|YP_149121.1|
Domain Number 1 Region: 3-43,80-358
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.46e-19
Family ABC transporter ATPase domain-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56421803|ref|YP_149121.1|
Sequence length 437
Comment hypothetical protein GK3268 [Geobacillus kaustophilus HTA426]
Sequence
MARIRIEHFGPVKLFDEEITDVTVLIGPQASGKSTISKLIFFFQSIPDEWVNYLLSVRQT
EENNPFFEFNKRLRRKFVGYFGTTKHMKPFHIRYEYDVEKFVRLDLKDGYVQIHFSDPLK
REIQENFKHVVQMKKEMQYEEQQLDDFWNVSSWKVRQQNVLEKVKAAITEVFGDSKTPIF
IPAGRSLVATLSDQLQDINPQQLDVLTEQFIERINLLKKMFSHSFEEIIEDRKKFSTEKI
DFEAIRLAIKMIEGVMKGKYMFSDYGERIFFNEREYTKLKFSSSGQQEVVWILLLIFTII
LERQRVFMVIEEPEAHLYPNAQKEMVALFALLLNVTNSTLVITTHSPYILSAFNIYLYAA
KIGNKLDQRVHPIVDRKLRLSPERLKAYMLESEGGKFHYRSIIDNELQFIQAEAIDEASS
AINRVLDELMEAEEAGE
Download sequence
Identical sequences A0A063YPI2 A0A098L0F0 A0A1C3D6F2 A0A1V9BSZ2 A0A2H5KIY0 G8MWQ3 Q5KUT3 T0Q5L7 V6VBD8
235909.GK3268 gi|375007702|ref|YP_004981335.1| gi|375010446|ref|YP_004984079.1| WP_011232738.1.100150 WP_011232738.1.19233 WP_011232738.1.2219 WP_011232738.1.22479 WP_011232738.1.25743 WP_011232738.1.45808 WP_011232738.1.60903 WP_011232738.1.6497 WP_011232738.1.70239 WP_011232738.1.78869 WP_011232738.1.8599 WP_011232738.1.90668 WP_011232738.1.91533 WP_011232738.1.93593 gi|56421803|ref|YP_149121.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]