SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421823|ref|YP_149141.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421823|ref|YP_149141.1|
Domain Number 1 Region: 191-497
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.88e-39
Family Extended AAA-ATPase domain 0.0089
Further Details:      
 
Domain Number 2 Region: 5-169
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.97e-33
Family ATP-dependent protease Lon (La), catalytic domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56421823|ref|YP_149141.1|
Sequence length 508
Comment hypothetical protein GK3288 [Geobacillus kaustophilus HTA426]
Sequence
MTVKILSIGLRGLEGYRVQVEVQEVPGIAAMVIVGLPDASVKEAKERVLASLYAFGCDFF
DKRLVVHLSPPERKKHSPMFDLAMAIGILKAMGKLTAPVSPDAAFLGSLSLDGAIQPVDG
MLPAILAAKKLGFQKVYLPYDPALPLHHLKDLDCIFVQTLEEAVQYLQGQRVLSLPPAFR
TPEIIDSPRKHHRDFQSIIGHHQAKRALEIAAAGGHHVLMVGPPGCGKSLLAETFPTILP
SLTHDAQLEVISLYQLAGEKIESGHPPFRHPYHSASSVSLIGGGTHPKPGEVSLAHRGVL
FLDEMAEFAKKTLDMLRQPLETGKVTISRISSTVTYPADFILLGAMNPCPCGYLGSRTRY
CTCSPKQIQAYRNRVSGPIYDRMDVLLSLEVIDFTKETRVSESSETIRKRVEEARRKQYE
RYGKEITNGRVSFELLMEKSPLANRQQLLLQQWASQHQWSNRVQTKIIRLARTISDLKGT
EKIADESLWEAMTLRWMKTYTKQQATAR
Download sequence
Identical sequences A0A1V9BLR6 Q5KUR3
WP_011232758.1.2219 WP_011232758.1.70239 gi|56421823|ref|YP_149141.1| 235909.GK3288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]