SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421893|ref|YP_149211.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421893|ref|YP_149211.1|
Domain Number 1 Region: 84-354
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.95e-92
Family RecA protein-like (ATPase-domain) 0.000000000233
Further Details:      
 
Domain Number 2 Region: 354-469
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 9.94e-53
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.000000718
Further Details:      
 
Domain Number 3 Region: 2-82
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 1.02e-29
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56421893|ref|YP_149211.1|
Sequence length 473
Comment ATP synthase F0F1 subunit beta [Geobacillus kaustophilus HTA426]
Sequence
MTRGRVIQVMGPVVDVKFENGHLPAIYNALKIQHKARNENEVDIDLTLEVALHLGDDTVR
TIAMASTDGLIRGMEVIDTGAPISVPVGEVTLGRVFNVLGEPIDLEGDIPADARRDPIHR
PAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHG
GISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFR
DEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTAKGSI
TSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLASTSRALAPEIVG
EEHYQVARKVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQF
TGQPGSYVPVKETVRGFKEILEGKYDHLPEDAFRLVGRIEEVVEKAKAMGVEV
Download sequence
Identical sequences A0A063Z0Y8 A0A0D8BXA3 A0A0E0TGM0 A0A0J0V8L3 A0A0K2H8I8 A0A0M4U1P9 A0A0N0Z4A5 A0A164F6R8 A0A1C3D5F8 A0A1V4PCN7 A0A1V9CTN4 A0A2H5KIR2 G8MZV4 L7ZWN4 Q5KUJ3 S7SV52 T0NRG3 V6VIL4
gi|261420763|ref|YP_003254445.1| 235909.GK3358 544556.GYMC61_3415 WP_011232825.1.100150 WP_011232825.1.13089 WP_011232825.1.17728 WP_011232825.1.19233 WP_011232825.1.20723 WP_011232825.1.2219 WP_011232825.1.22479 WP_011232825.1.25743 WP_011232825.1.3446 WP_011232825.1.38260 WP_011232825.1.38928 WP_011232825.1.46340 WP_011232825.1.50933 WP_011232825.1.57889 WP_011232825.1.59104 WP_011232825.1.60903 WP_011232825.1.62042 WP_011232825.1.6497 WP_011232825.1.65208 WP_011232825.1.70239 WP_011232825.1.76536 WP_011232825.1.77642 WP_011232825.1.80994 WP_011232825.1.8599 WP_011232825.1.86012 WP_011232825.1.90668 WP_011232825.1.9165 WP_011232825.1.92435 WP_011232825.1.93593 gi|319768433|ref|YP_004133934.1| gi|448239636|ref|YP_007403694.1| gi|56421893|ref|YP_149211.1| gi|297531558|ref|YP_003672833.1| gi|375010538|ref|YP_004984171.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]