SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421917|ref|YP_149235.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421917|ref|YP_149235.1|
Domain Number 1 Region: 91-369
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.92e-67
Family RecA protein-like (ATPase-domain) 0.0000000372
Further Details:      
 
Domain Number 2 Region: 4-49
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000000000051
Family Rho termination factor, N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 50-114
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000274
Family Cold shock DNA-binding domain-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56421917|ref|YP_149235.1|
Sequence length 424
Comment transcription termination factor Rho [Geobacillus kaustophilus HTA426]
Sequence
MELTLAALENMKLKELYELAKQYKISYYSKLTKKELIFAILKARAEQDGLFFMEGILEII
PSEGFGFLRPINYSPSSEDIYISASQIRRFDLRNGDKVSGKVRPPKENERYFGLLHVEAV
NGEDPEVAKERVHFPALTPLYPNRQMKLETTPDKLSTRIIDLIAPVGFGQRGLIVAPPKA
GKTMLLKEIANSITTNHPDVELIVLLIDERPEEVTDIERSVQGDVVSSTFDEVPENHIKV
AELVLERAMRLVEHKRDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFG
AARNIEEGGSLTILATALIDTGSRMDDVIYEEFKGTGNMELHLDRSLAERRIFPAIDIRR
SGTRKEELLIPKEHLEKLWAIRKTMADSPDFIERFLNKLRRTKSNEEFFALLDQEWKQGG
PPRL
Download sequence
Identical sequences A0A063YZP6 A0A098L028 A0A1D7NFP1 A0A1V4PCF9 A0A1V9BYM7 G8MZY0 L7ZWR4 Q5KUG9 T0P4A8 V6VIF2
WP_011232849.1.100150 WP_011232849.1.17728 WP_011232849.1.19233 WP_011232849.1.2219 WP_011232849.1.25743 WP_011232849.1.3446 WP_011232849.1.45808 WP_011232849.1.60903 WP_011232849.1.6497 WP_011232849.1.70239 WP_011232849.1.78869 WP_011232849.1.8599 WP_011232849.1.90668 WP_011232849.1.91533 WP_011232849.1.93593 gi|375010564|ref|YP_004984197.1| gi|56421917|ref|YP_149235.1| gi|448239661|ref|YP_007403719.1| 235909.GK3382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]