SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421924|ref|YP_149242.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421924|ref|YP_149242.1|
Domain Number 1 Region: 1-270
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.86e-129
Family Nitrogenase iron protein-like 0.0000000194
Further Details:      
 
Domain Number 2 Region: 290-529
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.52e-88
Family Class I glutamine amidotransferases (GAT) 0.000000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56421924|ref|YP_149242.1|
Sequence length 531
Comment CTP synthetase [Geobacillus kaustophilus HTA426]
Sequence
MTKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVF
VTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSAVIRKERRGDYLGGTVQVIPHITN
EIKERVFRAGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDVGRENVMYIHCTLVPY
IKAAGEMKTKPTQHSVKELRSLGIQPNVIVVRTEMPMPQEMKEKIALFCDIDPKAVIEAR
DADTLYAVPLMLQEQKLDQIVCEHLRLNCREADMTEWKALVEKVRNLSKTTKIALVGKYV
ELPDAYISVVEALRHAGYAFDTDIDIQWINAEHVTRDNVADLLKDADGILVPGGFGDRGV
EGKIEAIRYAREQRVPFLGICLGMQLASIEFARHVVGLSGAHSSEFDPNTPHPIIDLLPE
QKDVEDLGGTLRLGLYPCKLQEGTLAYAAYGDEVIYERHRHRYEFNNQYRPIMEEHGFVF
SGTSPDGRLVEVIELKDHPWFVAAQFHPEFTSRPTRPQPLFREFVRASLKE
Download sequence
Identical sequences A0A063Z230 A0A098KXU7 A0A1C3D7F8 A0A1V9BY89 A0A2H5KIN6 G8MZY8 L8A263 Q5KUG2 U2Y1H3 V6VHD4
gi|56421924|ref|YP_149242.1| gi|297531589|ref|YP_003672864.1| gi|375010572|ref|YP_004984205.1| WP_011232856.1.17728 WP_011232856.1.19233 WP_011232856.1.2219 WP_011232856.1.22479 WP_011232856.1.25743 WP_011232856.1.45808 WP_011232856.1.46340 WP_011232856.1.60903 WP_011232856.1.6497 WP_011232856.1.70239 WP_011232856.1.78869 WP_011232856.1.8599 WP_011232856.1.90668 WP_011232856.1.91533 WP_011232856.1.93593 235909.GK3389 gi|448239668|ref|YP_007403726.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]