SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421990|ref|YP_149308.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421990|ref|YP_149308.1|
Domain Number 1 Region: 1-235
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.43e-83
Family ABC transporter ATPase domain-like 0.000000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56421990|ref|YP_149308.1|
Sequence length 240
Comment amino acid ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MIDVRQLKKSFGSLQVLKGIDVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIII
DGINLKAKDTNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAKAMEL
LAKVGLQDKAHVYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMK
QLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIVEEGKPEDLFDHPQHERTKAFLSKVL
Download sequence
Identical sequences A0A063Z173 A0A0G3Y433 A0A0K1KBD0 A0A0K9HX36 A0A0Q0Y9P9 A0A163Y0H3 A0A1C3D5R0 A0A1V9BT97 Q5KU96 T0NZB2
gi|56421990|ref|YP_149308.1| WP_011232919.1.100150 WP_011232919.1.14676 WP_011232919.1.19233 WP_011232919.1.20351 WP_011232919.1.2219 WP_011232919.1.22479 WP_011232919.1.24107 WP_011232919.1.30801 WP_011232919.1.43576 WP_011232919.1.44827 WP_011232919.1.45808 WP_011232919.1.46681 WP_011232919.1.54348 WP_011232919.1.56669 WP_011232919.1.58461 WP_011232919.1.60903 WP_011232919.1.6497 WP_011232919.1.70239 WP_011232919.1.90668 235909.GK3455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]