SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56422010|ref|YP_149328.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56422010|ref|YP_149328.1|
Domain Number 1 Region: 1-426
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-177
Family Nitrogenase iron protein-like 0.00000000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56422010|ref|YP_149328.1|
Sequence length 428
Comment adenylosuccinate synthetase [Geobacillus kaustophilus HTA426]
Sequence
MSSVVVVGTQWGDEGKGKITDFLSENAEVIARYQGGNNAGHTIVFNGEKYKLHLIPSGIF
YKDKICVIGNGMVVDPKALVAELSYLHERGISTDNLRISNRAHVILPYHLKLDELEEERK
GANKIGTTKKGIGPAYMDKAARIGIRIVDLLDRDVFAEKLERNLREKNTLLEKVYGVEGF
RLEDIFEEYYEYGQHIAKYVCDTSVVLNNALDEGRRVLFEGAQGVMLDIDQGTYPFVTSS
NPVAGGVTIGAGVGPTKIKHVVGVAKAYTTRVGDGPFPTELHDEIGDRIREVGREYGTTT
GRPRRVGWFDSVVVRHARRVSGITDLSLNSIDVLTGIETLKICVAYRYRGQVLEEFPASL
KVLAECEPIYEELPGWTEDITGVKSLDELPANARHYVERISQLTGIPLSIFSVGPDRSQT
NVVRSVYA
Download sequence
Identical sequences A0A063Z193 A0A1C3D6E5 A0A1V9BWC1 G8N0V4 Q5KU76
gi|375010657|ref|YP_004984290.1| gi|56422010|ref|YP_149328.1| WP_011232939.1.100150 WP_011232939.1.19233 WP_011232939.1.2219 WP_011232939.1.22479 WP_011232939.1.25743 WP_011232939.1.45808 WP_011232939.1.60903 WP_011232939.1.6497 WP_011232939.1.70239 WP_011232939.1.78869 WP_011232939.1.8599 WP_011232939.1.90668 WP_011232939.1.91533 WP_011232939.1.93593 235909.GK3475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]