SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56422013|ref|YP_149331.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56422013|ref|YP_149331.1|
Domain Number 1 Region: 339-641
Classification Level Classification E-value
Superfamily DHH phosphoesterases 2.62e-64
Family Manganese-dependent inorganic pyrophosphatase (family II) 0.015
Further Details:      
 
Weak hits

Sequence:  gi|56422013|ref|YP_149331.1|
Domain Number - Region: 157-298
Classification Level Classification E-value
Superfamily Nucleotide cyclase 0.00282
Family GGDEF domain 0.066
Further Details:      
 
Domain Number - Region: 18-70
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0131
Family ABC transporter transmembrane region 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56422013|ref|YP_149331.1|
Sequence length 658
Comment hypothetical protein GK3478 [Geobacillus kaustophilus HTA426]
Sequence
MSHFYERKAYRYPLYALAALAVLMAIGLFYFQWLLGLVALLGVGFVLYYVIGAQRSLHKE
LEHYISNLSHRVKKVGEEALMQMPIGIMLIDEGGEIEWSNRFLAACFKEQTLVGRSLAEL
SESLAAFVKRGKTDEEIVELNGKQLKVVIRRPERLLYFFDVTEHLELKRQYEAERLVLAI
IFLDNYDEITQGMDDQAKSQLNSLVTSVLNRWANDYGIFLKRTSSDRFIAVLNEHILGRL
EKSKFSILDEVREQTAKHHAQLTLSIGIGAGVSQLPELGALAQSSLDLALGRGGDQVAIK
QGNGKVKFYGGKTNPMEKRTRVRARVISHALRELIAGSDKVLIMGHKYPDMDAMGAAIGV
LKVVQSNQKEGFIVVDPAKTDAGAQRLLEEMKKHAELWSRCLKPEQALELVTEDTLLIVV
DTHRPSLVIEERLLYRTDHIVVIDHHRRGEEFIEAPILVYMEPYASSTSELVTELLEYQP
KRMKLTMLEATALLAGIVVDTKSFTLRTGSRTFDAASYLRAQGADTVLVQKLLRESIANY
IKRAKLIERAVIDEHGIAIAKGGENEVHDQVLIAQTADTLLTLSSVVASFVISKRSDGTV
GISARSLGDVNVQVIMERLGGGGHLTNAAAQLSEVTVEEAERQLREAIHDYFEGGKPS
Download sequence
Identical sequences A0A063YY56 A0A098KYJ7 A0A1C3D6Q5 A0A1V9BW92 G8N0V7 Q5KU73 T0Q637 U2X3U3 V6V971
gi|375010660|ref|YP_004984293.1| gi|56422013|ref|YP_149331.1| WP_011232942.1.100150 WP_011232942.1.19233 WP_011232942.1.2219 WP_011232942.1.22479 WP_011232942.1.25743 WP_011232942.1.45808 WP_011232942.1.60903 WP_011232942.1.6497 WP_011232942.1.70239 WP_011232942.1.78869 WP_011232942.1.8599 WP_011232942.1.91533 WP_011232942.1.93593 235909.GK3478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]