SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420165|ref|YP_147483.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420165|ref|YP_147483.1|
Domain Number 1 Region: 325-566
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.41e-81
Family ABC transporter ATPase domain-like 0.0000025
Further Details:      
 
Domain Number 2 Region: 4-315
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 6.28e-66
Family ABC transporter transmembrane region 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56420165|ref|YP_147483.1|
Sequence length 578
Comment ABC transporter ATP-binding protein [Geobacillus kaustophilus HTA426]
Sequence
MGRVLIYLRPYWKWMALAWLFMLTELIIELWQPLLMGKIIDDGVMKQDVAAIFTWGAVML
GASLLAFASGIANSFAAAYVGQEYGFALRTALFAKIQSFSLARIEQLAPASLITRMTNDV
TQVQNMLFMSLRIALRAPLLVVFGVAMAFVVHARLALVLAVAVPLSAAFLLWVVQRAAAS
FSAVQRALDRVNGVMRENLAGMRLIKAWMRKEYEEERFAAANNALMERTMGVLRLIETIT
PVLLVLMNTAILALLFFGRLDVESGTASAGQVVAVVNYATRATAALSMFTFITMAFSRAR
ASAARLAELLEVPEERSGEHRADEPIVRRGEIRFEHVSFRYPDSELDALSDVSFVIHAQE
TAAILGATGSGKSTLLQLIPRLYEPGAGRVLIDGIDVREFSVEQLRMYVRFVPQEVLLFS
GTVADNLRFGKMTATMEEIVQAARDAQIHETITRFPDGYDALIGQKGVNLSGGQKQRLSI
ARALVGQPRILLLDDSTSALDAETEAKLLAALRRYACTTVIVTQKVSTAMAADTILLLED
GRLIAQGSHEQLLAASELYRRIVATQEGKKGSIDVTTA
Download sequence
Identical sequences A0A1V9BUK6 Q5KZH1
WP_011231125.1.2219 WP_011231125.1.70239 WP_011231125.1.93593 gi|56420165|ref|YP_147483.1| 235909.GK1630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]