SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56420393|ref|YP_147711.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56420393|ref|YP_147711.1|
Domain Number 1 Region: 8-106
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.7e-32
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56420393|ref|YP_147711.1|
Sequence length 110
Comment PTS system cellobiose-specific transporter subunit II A [Geobacillus kaustophilus HTA426]
Sequence
MEKIDVNQLTNEQVAFQLILHSGNARSKIVQAIREYRTGQVGEAERLIQEAEQDLSIAHD
VHFQLIQKEASGEQTNITLLLMHAEDHVMSTLAMKEVVKEMLALLKERNV
Download sequence
Identical sequences A0A063YT95 A0A1V4P8Q5 Q5KYU3
WP_011231348.1.2219 WP_011231348.1.3446 WP_011231348.1.72400 gi|56420393|ref|YP_147711.1| 235909.GK1858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]